PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15187.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 240aa    MW: 27236.9 Da    PI: 9.403
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15187.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.16.1e-52131411128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp+G+rF+Ptdeelv +yL++k++g++ ++ ++i+e+di+k+ePwdLp  + +k++++ew fF++ d+ky++g+r+nrat +gyWk
  Rsa1.0_15187.1_g00002.1  13 LPVGLRFRPTDEELVRFYLRRKINGHDDDV-KAIREIDICKWEPWDLPgfSVIKTNDSEWLFFCPLDRKYPNGSRQNRATIAGYWK 97 
                              799************************999.89***************6448888999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++++s++++ +g+k+tLvf++grapkg++t+W+mheyr+
  Rsa1.0_15187.1_g00002.1  98 ATGKDRKIKSSRNSIIGVKRTLVFHSGRAPKGTRTNWIMHEYRA 141
                              ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-589164IPR003441NAC domain
PROSITE profilePS5100555.10213164IPR003441NAC domain
PfamPF023652.0E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MNQNIKVLTL DSLPVGLRFR PTDEELVRFY LRRKINGHDD DVKAIREIDI CKWEPWDLPG  60
FSVIKTNDSE WLFFCPLDRK YPNGSRQNRA TIAGYWKATG KDRKIKSSRN SIIGVKRTLV  120
FHSGRAPKGT RTNWIMHEYR ATEDDLRGTN PGQSPFVICK LFKKQELSLE DEAAEPAVSS  180
SPTSSPDETK SEVSVVVKTE DVKRYDVAES SLVVSSGEAT TAKVRTLQSF NFRSLSVVFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-51316510169NAC domain-containing protein 19
3swm_B2e-51316510169NAC domain-containing protein 19
3swm_C2e-51316510169NAC domain-containing protein 19
3swm_D2e-51316510169NAC domain-containing protein 19
3swp_A2e-51316510169NAC domain-containing protein 19
3swp_B2e-51316510169NAC domain-containing protein 19
3swp_C2e-51316510169NAC domain-containing protein 19
3swp_D2e-51316510169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413530.0KP641353.1 Brassica napus NAC transcription factor 62-1.1 (NAC62-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149732.11e-143PREDICTED: NAC transcription factor 29
RefseqXP_013642396.11e-143PREDICTED: NAC domain-containing protein 62-like
SwissprotQ9SCK61e-132NAC62_ARATH; NAC domain-containing protein 62
TrEMBLA0A0X9GD101e-144A0A0X9GD10_BRANA; NAC transcription factor 62-1.1
STRINGBra017980.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-133NAC domain containing protein 62